Invitrogen™ Human AP2 beta (aa 108-163) Control Fragment Recombinant Protein

Product Code. 30193937

Brand: Invitrogen™ RP95302

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111042 (PA5-111042. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differentiation of specific cell types during embryonic development. Specific AP-2 family members differ in their expression patterns and binding affinity for different promoters. This protein functions as both a transcriptional activator and repressor. Mutations in this gene result in autosomal dominant Char syndrome, suggesting that this gene functions in the differentiation of neural crest cell derivatives.

Specifications

• Accession Number: Q92481
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7021
• Name: Human AP2 beta (aa 108-163) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: activating enhancer binding protein 2 beta; activating enhancer-binding protein 2 beta; activating enhancer-binding protein 2-beta; AI606113; AP-2(beta); AP-2 B; AP2-B; AP2-beta; E130018K07Rik; Tcfap2b; Tfap2b; transcription factor AP-2 beta; transcription factor AP-2 beta (activating enhancer binding protein 2 beta); transcription factor AP-2-beta
• Common Name: AP2 beta
• Gene Symbol: Tfap2b
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining