Invitrogen™ Human AP1S1 (aa 128-158) Control Fragment Recombinant Protein

Product Code. 30196794

Brand: Invitrogen™ RP104531

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63913 (PA5-63913. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AP1S1 is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle.

Specifications

• Accession Number: P61966
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1174
• Name: Human AP1S1 (aa 128-158) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: adapter-related protein complex 1 sigma-1 A subunit; adapter-related protein complex 1 subunit sigma-1 A; adaptor protein complex AP-1 sigma-1 A subunit; adaptor protein complex AP-1 subunit sigma-1 A; adaptor protein complex AP-1, sigma 1; adaptor related protein complex 1 sigma 1 subunit; adaptor related protein complex 1 subunit sigma 1; adaptor-related protein complex 1 sigma 1 subunit; adaptor-related protein complex 1 subunit sigma-1 A; adaptor-related protein complex 1, sigma 1 subunit; adaptor-related protein complex AP-1, sigma 1; AP-1 complex subunit sigma-1 A; AP19; AP1S1; ap1s1 protein; CLAPS1; Clathrin assembly protein complex 1 sigma-1 A small chain; clathrin coat assembly protein AP19; clathrin-associated/assembly/adaptor protein, small 1 (19 kD); EKV3; golgi adaptor HA1/AP1 adaptin sigma-1 A subunit; HA1 19 kDa subunit; MEDNIK; N-terminus-conjugating E2; sigma 1 A subunit of AP-1 clathrin; SIGMA1A; sigma1A subunit of AP-1 clathrin adaptor complex; sigma1A-adaptin; Sigma-adaptin 1 A; Ube2w; ubiquitin carrier protein W; ubiquitin-conjugating enzyme E2 W; ubiquitin-protein ligase W; WUGSC:H_DJ0747G18.2; zgc:56704; zgc:85689
• Common Name: AP1S1
• Gene Symbol: Ap1s1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KKSVLKAIEQADLLQEEDESPRSVLEEMGLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining