missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196142

Invitrogen™ Human AOX1 (aa 333-423) Control Fragment Recombinant Protein

Product Code. 30196142
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196142

Brand: Invitrogen™ RP96097

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59102 (PA5-59102. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AOX1 (Aldehyde oxidase 1) is a 1338 amino acid cytoplasmic protein that catalyzes the oxidation of a variety of aldehydes, leading to the production of hydrogen peroxide. Under certain conditions, AOX1 can catalyze the formation of the superoxide free radical. Defects in oxygen radical metabolism have been linked to the pathogenesis of amyotrophic lateral sclerosis (ALS), an autosomal dominant neurodegenerative disorder characterized by the death of motor neurons in the spinal cord, brain and brainstem. Significantly, AOX1 is highly expressed in the ventral horn of the spinal cord and the gene that encodes AOX1 is located in a chromosomal region that is frequently found to be implicated in ALS2. This evidence suggests that AOX1 is a candidate gene for ALS2.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q06278
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 316
Name Human AOX1 (aa 333-423) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI196512; AI255253; Aldehyde oxidase; aldehyde oxidase (female form); aldehyde oxidase 1; aldehyde oxidase 2; Ao; AOH1; Aox1; Aox-1; Aox2; Aox-2; Azaheterocycle hydroxylase; azaheterocycle hydroxylase 1; Moro; Retinal oxidase; Ro
Common Name AOX1
Gene Symbol AOX1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSRKWE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.