missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196142

Invitrogen™ Human AOX1 (aa 333-423) Control Fragment Recombinant Protein

Artikelnummer. 30196142
Klik for at se tilgængelige muligheder
Quantity:
100 μL
Pakningsstørrelse:
100µL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30196142

Brand: Invitrogen™ RP96097

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59102 (PA5-59102. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AOX1 (Aldehyde oxidase 1) is a 1338 amino acid cytoplasmic protein that catalyzes the oxidation of a variety of aldehydes, leading to the production of hydrogen peroxide. Under certain conditions, AOX1 can catalyze the formation of the superoxide free radical. Defects in oxygen radical metabolism have been linked to the pathogenesis of amyotrophic lateral sclerosis (ALS), an autosomal dominant neurodegenerative disorder characterized by the death of motor neurons in the spinal cord, brain and brainstem. Significantly, AOX1 is highly expressed in the ventral horn of the spinal cord and the gene that encodes AOX1 is located in a chromosomal region that is frequently found to be implicated in ALS2. This evidence suggests that AOX1 is a candidate gene for ALS2.
TRUSTED_SUSTAINABILITY

Tekniske data

Accession Number Q06278
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 316
Name Human AOX1 (aa 333-423) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI196512; AI255253; Aldehyde oxidase; aldehyde oxidase (female form); aldehyde oxidase 1; aldehyde oxidase 2; Ao; AOH1; Aox1; Aox-1; Aox2; Aox-2; Azaheterocycle hydroxylase; azaheterocycle hydroxylase 1; Moro; Retinal oxidase; Ro
Common Name AOX1
Gene Symbol AOX1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSRKWE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.