Invitrogen™ Human ANR44 (aa 624-673) Control Fragment Recombinant Protein

Product Code. 30208010

Brand: Invitrogen™ RP106712

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66022 (PA5-66022. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Putative regulatory subunit of protein phospatase 6 (PP6) that may be involved in the recognition of phosphoprotein substrates.

Specifications

• Accession Number: Q8N8A2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91526
• Name: Human ANR44 (aa 624-673) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ANKRD44; ankyrin repeat domain 44; ankyrin repeat domain-containing protein 44; PP6-ARS-B; protein phosphatase 6 ankyrin repeat subunit B; serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B; serine/threonine-protein phosphatase 6 regulatory subunit ARS-B
• Common Name: ANR44
• Gene Symbol: ANKRD44
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASIFVKDNVTKRTPLHASVINGHTLCLRLLLEIADNPEAVDVKDAKGQTP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining