Invitrogen™ Human ANO7 (aa 23-95) Control Fragment Recombinant Protein

Product Code. 30197814

Brand: Invitrogen™ RP96135

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (37%), Rat (37%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57378 (PA5-57378. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Has calcium-dependent phospholipid scramblase activity; scrambles phosphatidylserine, phosphatidylcholine and galactosylceramide. Does not exhibit calcium-activated chloride channel (CaCC) activity. May play a role in cell-cell interactions.

Specifications

• Accession Number: Q6IWH7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 50636
• Name: Human ANO7 (aa 23-95) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ANO7; anoctamin 7; anoctamin-7; Dresden transmembrane protein of the prostate; Dresden-transmembrane protein of the prostate; DTMPP; D-TMPP; IPCA5; IPCA-5; New gene expressed in prostate; NGEP; PCANAP5; PCANAP5L; prostate cancer associated protein 5; Prostate cancer-associated protein 5; TMEM16G; Transmembrane protein 16 G
• Common Name: ANO7
• Gene Symbol: ANO7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VRTGLYCRDQAHAERWAMTSETSSGSHCARSRMLRRRAQEEDSTVLIDVSPPEAEKRGSYGSTAHASEPGGQQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining