Invitrogen™ Human ANO3 (aa 178-263) Control Fragment Recombinant Protein

Produktkod. 30201845

Brand: Invitrogen™ RP97324

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59652 (PA5-59652. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the TMEM16 family of predicted membrane proteins, that are also known as anoctamins. While little is known about the function of this gene, mutations in this gene have been associated with some cases of autosomal dominant craniocervical dystonia. Cells from individuals with a mutation in this gene exhibited abnormalities in endoplasmic reticulum-dependent calcium signaling. Studies in rat show that the rat ortholog of this protein interacts with, and modulates the activity of a sodium-activated potassium channel. Deletion of this gene caused increased pain sensitivity in the rat model system. Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifikationer

• Accession Number: Q9BYT9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 63982
• Name: Human ANO3 (aa 178-263) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI838058; ANO3; anoctamin 3; anoctamin-3; anoctamin-3; LOW QUALITY PROTEIN: anoctamin-3; B230324K02Rik; C11orf25; DYT23; DYT24; GENX-3947; Tmem16c; transmembrane protein 16 C; transmembrane protein 16 C (eight membrane-spanning domains)
• Common Name: ANO3
• Gene Symbol: ANO3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DKRNTFEKNLRAEGLMLEKEPAIASPDIMFIKIHIPWDTLCKYAERLNIRMPFRKKCYYTDGRSKSMGRMQTYFRRIKNWMAQNPM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining