Invitrogen™ Human Annexin A1 (aa 1-102) Control Fragment Recombinant Protein

Product Code. 30210978

Brand: Invitrogen™ RP89916

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Annexin I belongs to a family of Ca (2+) -dependent phospholipid binding proteins that are preferentially located on the cytosolic face of the plasma membrane. Annexin I has a molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.

Specifications

• Accession Number: P04083
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 301
• Name: Human Annexin A1 (aa 1-102) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ANAX1; Annexin 1 (p35) (Lipocortin 1); annexin A1; Annexin I; annexin I (lipocortin I); annexin-1; ANX1; Anx-1; Anxa1; Anx-A1; C430014K04Rik; Calpactin II; calpactin-2; Chromobindin-9; lipocortin 1; lipocortin I; LPC1; Lpc-1; p35; Phospholipase A2 inhibitory protein; RP11-71A24.1
• Common Name: Annexin A1
• Gene Symbol: ANXA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining