Invitrogen™ Human ANKS1 (aa 262-360) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30198366	100 μL	100µL

Product Code. 30198366 Supplier Invitrogen™ Supplier No. RP94615

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57805 (PA5-57805. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulator of different signaling pathways. Regulates EPHA8 receptor tyrosine kinase signaling to control cell migration and neurite retraction.

Specifications

• Accession Number: Q92625
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23294
• Name: Human ANKS1 (aa 262-360) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ANKS1; ANKS1A; ankyrin repeat and SAM domain containing 1; ankyrin repeat and SAM domain-containing protein 1 A; ankyrin repeat and sterile alpha motif domain containing 1; ankyrin repeat and sterile alpha motif domain containing 1 A; KIAA0229; ODIN
• Common Name: ANKS1
• Gene Symbol: ANKS1A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VVQILLAAGTDVNIKDNHGLTALDTVRELPSQKSQQIAALIEDHMTGKRSTKEVDKTPPPQPPLISSMDSISQKSQGDVEKAVTELIIDFDANAEEEGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining