Invitrogen™ Human ANKRD57 (aa 16-101) Control Fragment Recombinant Protein

Product Code. 30208117

Brand: Invitrogen™ RP103798

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63252 (PA5-63252. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SOWAHC (Sosondowah Ankyrin Repeat Domain Family Member C) is a Protein Coding gene. An important paralog of this gene is SOWAHA. [GeneCards]

Specifications

• Accession Number: Q53LP3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 65124
• Name: Human ANKRD57 (aa 16-101) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ANKRD57; ankyrin repeat domain 57; ankyrin repeat domain-containing protein 57; Ankyrin repeat domain-containing protein SOWAHC; C2orf26; Protein sosondowah homolog C; sosondowah ankyrin repeat domain family member C; SOWAHC
• Common Name: ANKRD57
• Gene Symbol: SOWAHC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EAVLRFLAERGGRALHAELVQHFRGALGGEPEQRARARAHFKELVNAVATVRVDPADGAKYVHLKKRFCEGPSEPSGDPPRIQVTA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining