Invitrogen™ Human ANKRD53 (aa 117-198) Control Fragment Recombinant Protein

Product Code. 30182599

Brand: Invitrogen™ RP99654

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62011 (PA5-62011. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required for normal progression through mitosis. Involved in chromosome alignment and cytokinesis via regulation of microtubules polymerization.

Specifications

• Accession Number: Q8N9V6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79998
• Name: Human ANKRD53 (aa 117-198) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930564N15Rik; ANKRD53; ankyrin repeat domain 53; ankyrin repeat domain-containing protein 53
• Common Name: ANKRD53
• Gene Symbol: ANKRD53
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VGNVEWLRFCLNQSLREIPTDDKGFTAIHFAAQWGKLACLQVLVEEYKFPVDLLTNNSQTPLHLVIHRDNTTVALPCIYYLL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining