Invitrogen™ Human ANKRD46 (aa 17-151) Control Fragment Recombinant Protein

Product Code. 30195807

Brand: Invitrogen™ RP90564

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53086 (PA5-53086. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ANKRD46 encodes a protein containing multiple ankyrin repeats. Ankyrin domains function in protein-protein interactions in a variety of cellular processes. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q86W74
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 157567
• Name: Human ANKRD46 (aa 17-151) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110054N06Rik; AI314978; AI987733; ankrd46; ankrd46b; ANK-S; ankyrin repeat domain 46; ankyrin repeat domain 46 b; ankyrin repeat domain-containing protein 46; Ankyrin repeat small protein; GENX-115279; hypothetical protein LOC157567-like protein; loc157567 protein; RGD1309382; wu:fq41d11; zgc:109722
• Common Name: ANKRD46
• Gene Symbol: ANKRD46
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFNRGTHSKLETMQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining