Invitrogen™ Human ANKRD33 (aa 339-431) Control Fragment Recombinant Protein

Product Code. 30182656

Brand: Invitrogen™ RP97806

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59028 (PA5-59028. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ankyrin repeat domain 33 (ANKRD33), also named as C12orf7, belongs to the ankyrin repeat family and is highly expressed in retina. ANKRD33 exists as two isoforms. The isoform 1 molecular weight is 29 kDa and isoform 2 is 49 kDa. The function of ANKRD33 is still non-known.

Specifications

• Accession Number: Q7Z3H0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 341405
• Name: Human ANKRD33 (aa 339-431) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A930021G21Rik; Ankrd33; ankyrin repeat domain 33; ankyrin repeat domain-containing protein 33; C12orf7; LOC683410; PANKY; Panky-a; Photoreceptor ankyrin repeat protein; photorecptor ankyrin repeat protein A; similar to ankyrin repeat domain 33
• Common Name: ANKRD33
• Gene Symbol: ANKRD33
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SKSVPELLGTAPPPPLVPQSPPGSPQRSPWVFVPYQSPQGILSKCLQWLQPRDSTSPRPQVPKILLSKASSSSHQCQPKPSPSGHQSLALPLW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining