Invitrogen™ Human ANKRD26 (aa 1017-1083) Control Fragment Recombinant Protein

Product Code. 30197461

Brand: Invitrogen™ RP97039

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59579 (PA5-59579. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ANKRD26 encodes a protein containing N-terminal ankyrin repeats which function in protein-protein interactions. Mutations in this gene are associated with autosomal dominant thrombocytopenia-2. Pseudogenes of this gene are found on chromosome 7, 10, 13 and 16. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9UPS8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22852
• Name: Human ANKRD26 (aa 1017-1083) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730521P14Rik; ANKRD26; ankyrin repeat domain 26; ankyrin repeat domain-containing protein 26; bA145E8.1; BC008111; KIAA1074; mKIAA1074; RGD1310736; THC2
• Common Name: ANKRD26
• Gene Symbol: ANKRD26
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IHDRDQSETSKRELELAFQRARDECSRLQDKMNFDVSNLKDNNEILSQQLFKTESKLNSLEIEFHHT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining