Invitrogen™ Human ANKRD16 (aa 192-277) Control Fragment Recombinant Protein

Product Code. 30202092

Brand: Invitrogen™ RP102793

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58167 (PA5-58167. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required to prevent the misactivation of serine (Ser) with tRNA(Ala) by promoting the hydrolysis of Ser-mischarged tRNA(Ala), thereby playing a role in translational fidelity. Binds directly to the catalytic domain of AARS/AlaRS and captures Ser that is misactivated by AARS/AlaRS, preventing the charging of Ser adenylates to tRNA(Ala) and precluding Ser misincorporation in nascent peptides. [UniProt]

Specifications

• Accession Number: Q6P6B7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54522
• Name: Human ANKRD16 (aa 192-277) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810455F06Rik; AI646698; Ankrd16; ankyrin repeat domain 16; ankyrin repeat domain-containing protein 16; D430029B21Rik; hypothetical protein LOC550225; si:dkey-108d22.7; Unknown (protein for MGC:143369); zgc:110558
• Common Name: ANKRD16
• Gene Symbol: ANKRD16
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KRCQYEPDYRDNCGVTALMDAIQCGHIDVARLLLDEHGACLSAEDSLGAQALHRAAVTGQDEAIRFLVSELGVDVDVRATSTHLTA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining