missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201030

Invitrogen™ Human ANKRD11 (aa 640-733) Control Fragment Recombinant Protein

Product Code. 30201030
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201030

Brand: Invitrogen™ RP106235

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65561 (PA5-65561. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6UB99
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 29123
Name Human ANKRD11 (aa 640-733) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2410104C19Rik; 3010027A04Rik; 6330578C09Rik; 9530048I21Rik; AA930108; ANCO1; ANCO-1; ANKRD11; ankyrin repeat domain 11; ankyrin repeat domain-containing protein 11; Ankyrin repeat-containing cofactor 1; fc59e05; fi04c06; Gm176; LOW QUALITY PROTEIN: ankyrin repeat domain-containing protein 11; LZ16; nasopharyngeal carcinoma susceptibility protein; T13; truncated ankyrin repeat domain 11 aberrant transcript 1; truncated ankyrin repeat domain 11 aberrant transcript 2; wu:fc59e05; wu:fi04c06; Yod
Common Name ANKRD11
Gene Symbol ANKRD11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NKEKGQCSISQELKLKSFTYEYEDSKQKSDKAILLENDLSTENKLKVLKHDRDHFKKEEKLSKMKLEEKEWLFKDEKSLKRIKDTNKDISRSFR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.