missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206448

Invitrogen™ Human ANKMY2 (aa 240-331) Control Fragment Recombinant Protein

Product Code. 30206448
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206448

Brand: Invitrogen™ RP92679

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111207 (PA5-111207. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ANKMY2 (ankyrin repeat and MYND domain containing 2) is a 441 amino acid protein that contains three ANK repeats and one MYND-type zinc finger. Encoded by a gene that maps to human chromosome 7p21.1, ANKMY2 is conserved in chimpanzee, dog, cow, mouse, chicken, zebrafish, fruit fly, mosquito and Caenorhabditis elegans. Downregulation of ANKMY2, associated with frequent deletions of human chromosome 7p22.1, indicate that ANKMY2 may role a role in the pathogenesis of natural killer (NK)-cell malignancies. ANKMY2 is also upregulated by enforced expression of Hox11, which functions broadly to hinder hemopoiesis, diverts differentiation to an alternative fate and promotes pre-leukaemic states.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8IV38
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57037
Name Human ANKMY2 (aa 240-331) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI035571; ANKMY2; ankyrin repeat and MYND domain containing 2; ankyrin repeat and MYND domain-containing protein 2; EGK_13887; Gna14; guanine nucleotide binding protein, alpha 14; LOW QUALITY PROTEIN: ankyrin repeat and MYND domain-containing protein 2; ZMYND20
Common Name ANKMY2
Gene Symbol Ankmy2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ENKLDTLIKSLLKGRASDGFPVYQEKIIRESIRKFPYCEATLLQQLVRSIAPVEIGSDPTAFSVLTQAITGQVGFVDVEFCTTCGEKGASKR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.