Invitrogen™ Human ANGEL2 (aa 116-209) Control Fragment Recombinant Protein

Product Code. 30207959

Brand: Invitrogen™ RP108797

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140056 (PA5-140056. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ANGEL 2 is a member of the CCR4/nocturin family.

Specifications

• Accession Number: Q5VTE6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 90806
• Name: Human ANGEL2 (aa 116-209) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610307I21Rik; 5730410O10Rik; AI845692; angel homolog 2; angel homolog 2 (Drosophila); ANGEL2; Ccr4d; D1Ertd396e; D1Ertd654e; KIAA0759L; MNCb-4273; Protein angel homolog 2; RGD1305056
• Common Name: ANGEL2
• Gene Symbol: ANGEL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EGDEPSSKRRKHQGVIKRNWEYICSHDKEKTKILGDKNVDPKCEDSENKFDFSVMSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining