missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human AMZ2 (aa 31-104) Control Fragment Recombinant Protein

Product Code. 30205346
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205346

Brand: Invitrogen™ RP93542

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54751 (PA5-54751. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AMZ2 (archaelysin family metallopeptidase 2), also known as archaemetzincin-2 or archeobacterial metalloproteinase-like protein 2, is a 360 amino acid protein belonging to the peptidase M54 family. Encoded by a gene that maps to human chromosome 17q24.2, AMZ2 is predominantly expressed in heart and testis. AMZ2 is also expressed in kidney, liver, pancreas, lung, brain and placenta, and in fetal tissues such as kidney, liver, lung and brain. AMZ2 participates in metal ion binding and functions as a zinc metalloprotease. AMZ2 is inhibited by both general metalloprotease inhibitors o-phenanthroline and batimastat. Exhibiting aminopeptidase activity, AMZ2 acts against Angiotensin in vitro, but does not hydrolyze either Neurogranin or Angiotensin.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86W34
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51321
Name Human AMZ2 (aa 31-104) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA408420; Amz2; archaelysin family metallopeptidase 2; archaemetzincin-2; archaemetzincins-2; archeobacterial metalloproteinase-like 2; archeobacterial metalloproteinase-like protein 2; BM-014; ESTM12; RGD1304846; X83328
Common Name AMZ2
Gene Symbol AMZ2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AGEQRLMNEAFQPASDLFGPITLHSPSDWITSHPEAPQDFEQFFSDPYRKTPSPNKRSIYIQSIGSLGNTRIIS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.