Invitrogen™ Human Amyloid Precursor Protein Control Fragment Recombinant Protein

Product Code. 30210924

Brand: Invitrogen™ RP94789

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Amyloid Precursor Protein (APP) or Amyloid beta precursor protein functions as a cell surface kinesin I membrane receptor, mediating the axonal transport of beta-secretase and presenilin 1. APP is important for neurite growth, neuronal adhesion and axonogenesis. APP is a 100-140 kDa transmembrane glycoprotein that exists as several isoforms resulting from alternative splicing. Proteolytic cleavage of APP by beta- and gamma-secretases results in the generation of beta amyloid, which is the primary component of senile plaques. Senile plaques are one of the major histopathologic features of Alzheimer's disease. Abnormal regulation and processing of APP also plays a role in Down's syndrome, early onset familial Alzheimer's disease, and cerebral hemorrhage.

Specifications

• Accession Number: P05067
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 351
• Name: Human Amyloid Precursor Protein Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A4; AAA; ABETA; Abeta40; Abeta42; ABPP; AD1; Adap; AG; AICD-50; AICD-57; AICD-59; AID(50); AID(57); AID(59); Alpha-CTF; Alpha-secretase C-terminal fragment; Alzheimer disease amyloid A4 protein homolog; alzheimer disease amyloid protein; amyloid A4; Amyloid b precursor protein; amyloid beta (A4) precursor protein; amyloid beta A4 protein; amyloid beta precursor protein; Amyloid intracellular domain 50; Amyloid intracellular domain 57; Amyloid intracellular domain 59; Amyloid precursor protein; Amyloid β precursor protein; Amyloid-beta A4 protein; Amyloid-beta precursor protein; Amyloid-beta protein 40; Amyloid-beta protein 42; Amyloidogenic glycoprotein; APP; APP-C57; APP-C59; APP-C99; APPI; appican; beta-amyloid peptide; beta-amyloid peptide(1-40); beta-amyloid peptide(1-42); beta-amyloid precursor protein; betaApp; Beta-APP40; Beta-APP42; Beta-CTF; Beta-secretase C-terminal fragment; C31; C80; C83; C99; Cerebral vascular amyloid peptide; CTFgamma; CVAP; E030013M08Rik; Gamma-CTF(50); Gamma-CTF(57); Gamma-CTF(59); Gamma-secretase C-terminal fragment 50; Gamma-secretase C-terminal fragment 57; Gamma-secretase C-terminal fragment 59; N-APP; P3(40); P3(42); Pan-Abeta; peptidase nexin-II; PN2; PN-II; PreA4; protease nexin II; protease nexin-II; S-APP-alpha; S-APP-beta; Soluble APP-alpha; Soluble APP-beta; testicular tissue protein Li 2
• Common Name: Amyloid Precursor Protein
• Gene Symbol: APP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAKDVGSN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining