Invitrogen™ Human AMPK beta-1 (aa 1-100) Control Fragment Recombinant Protein

Product Code. 30210810

Brand: Invitrogen™ RP102326

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82147 (PA5-82147. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AMPK beta 1 is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex.

Specifications

• Accession Number: Q9Y478
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5564
• Name: Human AMPK beta-1 (aa 1-100) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300015D22Rik; 5'-AMP-activated protein kinase 40 kDa subunit; 5-AMP-activated protein kinase beta subunit; 5'-AMP-activated protein kinase beta-1 subunit; 5'-AMP-activated protein kinase subunit beta-1; 5'-AMP-activated protein kinase subunit beta-1-like protein; 5'-AMP-activated protein kinase, beta subunit; AAKB1; AMP-activated protein kinase beta subunit; AMPK; AMPK beta 1; AMPK beta -1 chain; AMPK beta-1 chain; AMPK subunit beta-1; AMPKb; AMPK-beta1; AU021155; E430008F22; HAMPKb; kinase AMPK-beta1; kinase pAMPK; pAMPK; Prkab1; protein kinase AMP-activated non-catalytic subunit beta 1; protein kinase, AMP-activated, beta 1 non-catalytic subunit; protein kinase, AMP-activated, noncatalytic, beta-1
• Common Name: AMPK beta-1
• Gene Symbol: PRKAB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining