Invitrogen™ Human Amisyn (aa 54-191) Control Fragment Recombinant Protein

Product Code. 30193786

Brand: Invitrogen™ RP89139

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51960 (PA5-51960. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STXBP6 binds components of the SNARE complex.

Specifications

• Accession Number: Q8NFX7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29091
• Name: Human Amisyn (aa 54-191) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Amisyn; BC024598; C85317; FLJ39638; HSPC156; OTTHUMP00000178754; stxbp6; syntaxin binding protein 6; syntaxin binding protein 6 (amisyn); syntaxin-binding protein 6; Unknown (protein for MGC:134570); wu:fd20e06; zgc:86678
• Common Name: Amisyn
• Gene Symbol: Stxbp6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NKKPTQASITKVKQFEGSTSFVRRSQWMLEQLRQVNGIDPNGDSAEFDLLFENAFDQWVASTASEKCTFFQILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERLGRAEEKTEDLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining