Invitrogen™ Human Aminoacylase (aa 247-332) Control Fragment Recombinant Protein

Product Code. 30212108

Brand: Invitrogen™ RP96317

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ACY1 encodes a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and an acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. This gene is located on chromosome 3p21. 1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and this enzyme is the first member of a new family of zinc-binding enzymes. Mutations in this gene cause aminoacylase-1 deficiency, a metabolic disorder characterized by central nervous system defects and increased urinary excretion of N-acetylated amino acids. Alternative splicing of this gene results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ABHD14A (abhydrolase domain containing 14A) gene. A related pseudogene has been identified on chromosome 18.

Specifications

• Accession Number: Q03154
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 95
• Name: Human Aminoacylase (aa 247-332) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110014J22Rik; ACY IA; ACY IB; ACY1; ACY-1; Acy1a; ACY-1 A; Acy1b; ACY-1 B; ACY1D; acylase; aminoacylase 1; aminoacylase I; aminoacylase-1; Aminoacylase-1 A; aminoacylase-1 B; epididymis secretory protein Li 5; HEL-S-5; N-acylamino acid aminohydrolase (Aminoacylase 1); N-acyl-L-amino-acid amidohydrolase
• Common Name: Aminoacylase
• Gene Symbol: ACY1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining