Invitrogen™ Human AMICA (aa 297-379) Control Fragment Recombinant Protein

Product Code. 30206555

Brand: Invitrogen™ RP88832

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (42%), Rat (42%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61621 (PA5-61621. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AMICA transmembrane protein of the plasma membrane of leukocytes that control their migration and activation through interaction with CXADR, a plasma membrane receptor found on adjacent epithelial and endothelial cells. The interaction between both receptors mediates the activation of gamma-delta T-cells, a subpopulation of T-cells residing in epithelia and involved in tissue homeostasis and repair. Upon epithelial CXADR-binding, JAML induces downstream cell signaling events in gamma-delta T-cells through PI3-kinase and MAP kinases. It results in proliferation and production of cytokines and growth factors by T-cells that in turn stimulate epithelial tissues repair. It also controls the transmigration of leukocytes within epithelial and endothelial tissues through adhesive interactions with epithelial and endothelial CXADR.

Specifications

• Accession Number: Q86YT9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 120425
• Name: Human AMICA (aa 297-379) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: adhesion molecule AMICA; adhesion molecule interacting with CXADR antigen 1; adhesion molecule, interacts with CXADR antigen 1; AMICA; Amica1; Crea7; CREA7-1; CREA7-4; Dendritic cell-specific protein CREA7; Dendritic cell-specific protein CREA7-1; dendritic-cell specific protein Crea7; dendritic-cell specific protein CREA7-1; dendritic-cell specific protein CREA7-4; Gm638; Jaml; junction adhesion molecule like; junctional adhesion molecule-like; mCrea7; UNQ722/PRO1387
• Common Name: AMICA
• Gene Symbol: JAML
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KKTCGNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEEEEPSEKSEATYMTMHPVWPSLRSDRNNSL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining