missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ALS2CR2 (aa 338-411) Control Fragment Recombinant Protein

Product Code. 30204984
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204984

Brand: Invitrogen™ RP95061

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110960 (PA5-110960. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that belongs to the serine/threonine protein kinase STE20 subfamily. One of the active site residues in the protein kinase domain of this protein is altered, and it is thus a pseudokinase. This protein is a component of a complex involved in the activation of serine/threonine kinase 11, a master kinase that regulates cell polarity and energy-generating metabolism. This complex regulates the relocation of this kinase from the nucleus to the cytoplasm, and it is essential for G1 cell cycle arrest mediated by this kinase. The protein encoded by this gene can also interact with the X chromosome-linked inhibitor of apoptosis protein, and this interaction enhances the anti-apoptotic activity of this protein via the JNK1 signal transduction pathway. Two pseudogenes, located on chromosomes 1 and 7, have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9C0K7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55437
Name Human ALS2CR2 (aa 338-411) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA792893; Als2cr2; amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 2; amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein homolog; B830008M19; CALS-21; D1Ucla2; ILP-interacting protein; ILP-interacting protein homolog; ILP-interacting protein ILPIPA; ILPIP; ILPIPA; MGC102916; Papk; polyploidy associated protein kinase; polyploidy associated protein kinase PAPK-A; polyploidy-associated protein kinase; PRO1038; pseudokinase ALS2CR2; RGD1559449; STE20 related adaptor beta; STE20-related kinase adapter protein beta; STE20-related kinase adaptor beta; STRAD beta; Stradb; Syradb
Common Name ALS2CR2
Gene Symbol STRADB
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.