missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ALS2CR12 (aa 66-146) Control Fragment Recombinant Protein

Product Code. 30210040
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
This item is not returnable. View return policy

Product Code. 30210040

missing translation for 'mfr': Invitrogen™ RP96156

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57399 (PA5-57399. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ALS2CR12 is a protein coding gene and gene ontology (GO) annotation includes cytoplasm; outer dense fiber; sperm fibrous sheath; sperm flagellum.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96Q35
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 130540
Name Human ALS2CR12 (aa 66-146) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ALS2CR12; amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12; amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein; amyotrophic lateral sclerosis 2 chromosome region candidate 12; amyotrophic lateral sclerosis 2 chromosome region, candidate 12; FLACC1; Flagellum-associated coiled-coil domain-containing protein 1
Common Name ALS2CR12
Gene Symbol ALS2CR12
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HSARQEETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQISELTAIIEQMNR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.