Invitrogen™ Human ALS2CR12 (aa 66-146) Control Fragment Recombinant Protein

Product Code. 30210040

Brand: Invitrogen™ RP96156

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57399 (PA5-57399. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ALS2CR12 is a protein coding gene and gene ontology (GO) annotation includes cytoplasm; outer dense fiber; sperm fibrous sheath; sperm flagellum.

Specifications

• Accession Number: Q96Q35
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 130540
• Name: Human ALS2CR12 (aa 66-146) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ALS2CR12; amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12; amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein; amyotrophic lateral sclerosis 2 chromosome region candidate 12; amyotrophic lateral sclerosis 2 chromosome region, candidate 12; FLACC1; Flagellum-associated coiled-coil domain-containing protein 1
• Common Name: ALS2CR12
• Gene Symbol: ALS2CR12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HSARQEETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQISELTAIIEQMNR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining