missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194959

Invitrogen™ Human ALS2CR1 (aa 33-118) Control Fragment Recombinant Protein

Product Code. 30194959
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194959

Brand: Invitrogen™ RP96226

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111073 (PA5-111073. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ALS2CR1 may function as a transcriptional corepressor through its interaction with COPS2, negatively regulating the expression of genes involved in neuronal differentiation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9GZT8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 60491
Name Human ALS2CR1 (aa 33-118) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110030G24Rik; ALS2CR1; amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 1; amyotrophic lateral sclerosis 2 chromosomal region candidate gene 1 protein; CALS-7; GTP cyclohydrolase I; MDS015; My018; Ngg1 interacting factor 3 homolog-like 1; NGG1 interacting factor 3 like 1; Ngg1 interacting factor 3-like 1; Ngg1 interacting factor 3-like 1 (S. pombe); NIF3 (Ngg1 interacting factor 3, S.pombe homolog)-like 1; NIF3 NGG1 interacting factor 3-like 1; NIF3 NGG1 interacting factor 3-like 1 (S. cerevisiae); Nif3l1; NIF3-like protein 1; OTTHUMP00000206190; OTTHUMP00000206191; OTTHUMP00000206192; putative GTP cyclohydrolase 1 type 2 Nif3l1
Common Name ALS2CR1
Gene Symbol NIF3L1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLSSLNDFASLSFAESWDNVGLLVEPSPPHTVNTLFLTNDLTEEVMEEVLQKKADLILSYHPPIFRPMKRITWNTWKERLVIRALE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.