Invitrogen™ Human ALS (aa 539-604) Control Fragment Recombinant Protein

Product Code. 30182509

Brand: Invitrogen™ RP98357

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59252 (PA5-59252. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in this gene are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty. Three transcript variants encoding two different isoforms have been found for this gene.

Specifications

• Accession Number: P35858
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3483
• Name: Human ALS (aa 539-604) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ACLSD; Albs; Als; IGFALS; insulin like growth factor binding protein acid labile subunit; insulin-like growth factor binding protein complex acid labile chain; insulin-like growth factor binding protein complex acid-labile subunit; insulin-like growth factor binding protein, acid labile subunit; insulin-like growth factor-binding protein complex acid labile chain; insulin-like growth factor-binding protein complex acid labile subunit; mKIAA4111
• Common Name: ALS
• Gene Symbol: IGFALS
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPEVVGLDLRDLSEAHFAP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining