missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human alpha Amylase 1 (aa 242-300) Control Fragment Recombinant Protein

Product Code. 30209820
Click to view available options
Quantity:
100 μL
missing translation for 'unitSize'
100µL
This item is not returnable. View return policy

Product Code. 30209820

missing translation for 'mfr': Invitrogen™ RP104388

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P0DUB6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 276
Name Human alpha Amylase 1 (aa 242-300) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1,4-alpha-D-glucan glucanohydrolase 1; alpha amylase 1; alpha-amylase 1; Amy1; Amy-1; Amy1a; Amy-1-a; AMY1B; AMY1C; AMY2A; amylase 1, salivary; amylase, alpha 1 A (salivary); amylase, salivary, alpha-1 A; C030014B17Rik; glycogenase; PA; salivary alpha-amylase; salivary amylase; salivary amylase alpha 1 A; salivary and hepatic alpha-amylase
Common Name alpha Amylase 1
Gene Symbol AMY1A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.