Invitrogen™ Human alpha-1 Microglobulin (aa 41-115) Control Fragment Recombinant Protein

Product Code. 30211575

Brand: Invitrogen™ RP109491

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes.

Specifications

• Accession Number: P02760
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 259
• Name: Human alpha-1 Microglobulin (aa 41-115) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A1M; AI194774; alpha 1 microglobulin/bikunin; alpha-1 microglobulin; Alpha-1 microglobulin/bikunin; Alpha-1 microglycoprotein; Alpha-1-microglobulin; alpha-1-microglobulin/bikunin; alpha1-microglobulin/bikunin; alpha-1-microglobulin/bikunin precursor; alpha-1-microglobulin-bikunin; alpha1-microglobulin-bikunin precursor; Ambp; AMBP protein; ASPI; BI-14; Bikunin; complex-forming glycoprotein heterogeneous in charge; Cumulus extracellular matrix-stabilizing factor; EDC1; ESF; growth-inhibiting protein 19; HCP; HI30; HI-30; IATIL; inter-alpha-trypsin inhibitor (protein HC), light; inter-alpha-trypsin inhibitor light chain; Intin4; ITI; ITIL; ITILC; ITI-LC; polyprotein; protein AMBP; Protein HC; Protein Protein HC; trypstatin; ulinastatin; unnamed protein product; Urinary Trypsin Inhibitor; uristatin; uronic-acid-rich protein; UTI
• Common Name: alpha-1 Microglobulin
• Gene Symbol: AMBP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining