Invitrogen™ Human ALOX15 (aa 114-231) Control Fragment Recombinant Protein

Product Code. 30212948

Brand: Invitrogen™ RP90629

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53097 (PA5-53097. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. The protein also acts on C-12 of arachidonate as well as on linoleic acid.

Specifications

• Accession Number: P16050
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 246
• Name: Human ALOX15 (aa 114-231) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 12/15-lipoxygenase; 12/15-LO; 12/15-LOX; 12-LO; 12-LOX; 15-lipooxygenase-1; 15-LOX; 15-LOX-1; 15 LOX-1; 15-LO x 2; Alo x 12; Alo x 12 L; Alo x 15; Arachidonate 12-lipoxygenase, leukocyte-type; arachidonate 15-lipoxygenase; Arachidonate omega-6 lipoxygenase; L-12 LO; LOG15
• Common Name: ALOX15
• Gene Symbol: Alox15
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining