Invitrogen™ Human ALOX12B (aa 423-516) Control Fragment Recombinant Protein

Product Code. 30210132

Brand: Invitrogen™ RP93477

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54949 (PA5-54949. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an enzyme involved in the converstion of arachidonic acid to 12R-hydroxyeicosatetraenoic acid. Mutations in this gene are associated with nonbullous congenital ichthyosiform erythroderma.

Specifications

• Accession Number: O75342
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 242
• Name: Human ALOX12B (aa 423-516) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 12 R-lipoxygenase; 12 R-LOX; Alo x 12 b; alo x 12 b {ECO:0000312; Aloxe2; arachidonate 12-lipoxygenase, 12 R type; arachidonate 12-lipoxygenase, 12 R-type; ARCI2; e-LOX 2; e-LO x 2; epidermis-type lipoxygenase 12; Epidermis-type lipoxygenase 2; RGD:1305330}
• Common Name: ALOX12B
• Gene Symbol: ALOX12B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLYLPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining