Invitrogen™ Human ALOX12 (aa 116-195) Control Fragment Recombinant Protein

Product Code. 30193850

Brand: Invitrogen™ RP109074

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Oxygenase and 14,15-leukotriene A4 synthase activity.

Specifications

• Accession Number: P18054
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 239
• Name: Human ALOX12 (aa 116-195) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 12-lipoxygenase; 12 LO; 12-LO; 12 LOX; 12-LOX; 12 S LOX; 12 S-lipoxygenase; 12 S-LOX; 9930022G08Rik; ALO x 12; Alo x 12 p; arachidonate 12-lipoxygenase; arachidonate 12-lipoxygenase, 12 S type; arachidonate 12-lipoxygenase, 12 S-type; Arachidonate 15-lipoxygenase,15 S-type; Linoleate 13 S-lipoxygenase; Lipoxin synthase 12-LO; LOG12; P-12 LO; platelet 12-LOX; platelet-type 12-lipoxygenase; platelet-type lipoxygenase 12
• Common Name: ALOX12
• Gene Symbol: ALOX12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PGDNALDMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTLLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining