Invitrogen™ Human ALMS1 (aa 3513-3588) Control Fragment Recombinant Protein

Product Code. 30195042

Brand: Invitrogen™ RP96044

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60275 (PA5-60275. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

THRAP3 is a 955 amino acid novel nuclear receptor and a member of the Thyroid hormone receptor associated proteins with a LISH domain and no obvious known sequence motifs. THRAP3 is a 150 kDa subunit of the large multiprotein complex TRAP and is important in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It is also known to play an important role in transcriptional coactivation. It is known to interact with DKC1, nop5/nap65 and fibrillarin. From the Northern blot analysis of several human tissues it was found that TRAP150 is ubiquitously expressed.

Specifications

• Accession Number: Q8TCU4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7840
• Name: Human ALMS1 (aa 3513-3588) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Alms1; ALMS1, centrosome and basal body associated protein; ALSS; Alstrom syndrome 1; Alstrom syndrome 1 homolog; Alstrom syndrome protein 1; DKFZp686A118; DKFZp686D1828; KIAA0328
• Common Name: ALMS1
• Gene Symbol: ALMS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DFFQHHPDKHREHMCLPLPYQNMDKTKTDYTRIKSLSINVNLGNKEVMDTTKSQVRDYPKHNGQISDPQRDQKVTP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining