Invitrogen™ Human Allergin 1 (aa 20-155) Control Fragment Recombinant Protein

Product Code. 30197406

Brand: Invitrogen™ RP108148

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82501 (PA5-82501. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Allergin 1 is a protein coding gene. Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction.

Specifications

• Accession Number: Q7Z6M3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 284021
• Name: Human Allergin 1 (aa 20-155) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Allergin-1; Allergy inhibitory receptor 1; C17orf60; Gm885; mast cell Ag-32; mast cell antigen 32; mast cell immunoglobulin like receptor 1; mast cell immunoglobulin-like receptor 1; MCA32; MCA-32; MCA32-1S2; Milr1; probable mast cell antigen 32 homolog; surface protein MCA-32
• Common Name: Allergin 1
• Gene Symbol: MILR1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining