missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ALKBH8 (aa 133-234) Control Fragment Recombinant Protein

Product Code. 30211580
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211580

Brand: Invitrogen™ RP97368

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58517 (PA5-58517. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA via its methyltransferase domain (PubMed:20123966, PubMed:20308323). Catalyzes the last step in the formation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA (PubMed:20123966, PubMed:20308323). Has a preference for tRNA(Arg) and tRNA(Glu), and does not bind tRNA(Lys)(PubMed:20308323). Binds tRNA and catalyzes the iron and alpha-ketoglutarate dependent hydroxylation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA via its dioxygenase domain, giving rise to 5-(S)-methoxycarbonylhydroxymethyluridine; has a preference for tRNA(Gly) (PubMed:21285950). Required for normal survival after DNA damage (PubMed:20308323). May inhibit apoptosis and promote cell survival and angiogenesis (PubMed:19293182).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96BT7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 91801
Name Human ALKBH8 (aa 133-234) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930562C03Rik; 8030431D03Rik; 9430088N01Rik; ABH8; alkB homolog 8, tRNA methyltransferase; AlkB homologue 8; alkB, alkylation repair homolog 8; alkB, alkylation repair homolog 8 (E. coli); Alkbh8; Alkylated DNA repair protein alkB homolog 8; LOW QUALITY PROTEIN: alkylated DNA repair protein alkB homolog 8; probable alpha-ketoglutarate-dependent dioxygenase ABH8; RGD1304687; S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8; TRM9; TRMT9; tRNA (carboxymethyluridine(34)-5-O)-methyltransferase ABH8; tRNA methyltransferase 9 homolog
Common Name ALKBH8
Gene Symbol ALKBH8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LPPGLMVVEEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFGYEFHYENNNVDKDKPLSGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.