Invitrogen™ Human ALKBH7 (aa 100-188) Control Fragment Recombinant Protein

Product Code. 30198207

Brand: Invitrogen™ RP96561

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58959. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ALKBH7 (alkB, alkylation repair homolog 7), also known as SPATA11, is a 221 amino acid protein belonging to the alkB family. ALKBH7 is one of many homologs of the Escherichia coli protein AlkB. AlkB functions to protect DNA and RNA against damage from environmental methylating compounds by directly reversing 1-methyladenine (1-meA) and 3-methylcytosine (3-meC) cytotoxic alkylation lesions in DNA and RNA. The enzyme acts by oxidative demethylation, utilizing ferrous iron and alpha-ketoglutarate as cofactors, 2-oxoglutarate as a co-substrate and molecular oxygen as the oxidizing agent. ALKBH7 is encoded by a gene located on human chromosome 19, which consists of over 63 million bases, houses approximately 1,400 genes and is recognizedfor having the greatest gene density of the human chromosomes.

Specifications

• Accession Number: Q9BT30
• Concentration: 8.2 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 84266
• Name: Human ALKBH7 (aa 100-188) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2310045B01Rik; 2510008E23Rik; Abh7; alkB homolog 7; alkB, alkylation repair homolog 7; alkB, alkylation repair homolog 7 (E. coli); Alkbh7; Alkylated DNA repair protein alkB homolog 7; alpha-ketoglutarate-dependent dioxygenase alkB homolog 7, mitochondrial; probable alpha-ketoglutarate-dependent dioxygenase ABH7; SPATA11; spermatogenesis associated 11; spermatogenesis cell proliferation related protein; spermatogenesis cell proliferation-related protein; Spermatogenesis-associated protein 11; UNQ6002; UNQ6002/PRO34564
• Common Name: ALKBH7
• Gene Symbol: ALKBH7
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining