missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30180767

Invitrogen™ Human ALKBH4 (aa 43-114) Control Fragment Recombinant Protein

Product Code. 30180767
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30180767

Brand: Invitrogen™ RP98508

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62407 (PA5-62407. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dioxygenase that mediates demethylation of actin monomethylated at 'Lys-84' (K84me1), thereby acting as a regulator of actomyosin-processes (PubMed:23673617). Demethylation of actin K84me1 is required for maintaining actomyosin dynamics supporting normal cleavage furrow ingression during cytokinesis and cell migration (PubMed:23673617). In addition to proteins, also demethylates DNA: specifically demethylates DNA methylated on the 6th position of adenine (N(6)-methyladenosine) DNA, thereby regulating Polycomb silencing. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NXW9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54784
Name Human ALKBH4 (aa 43-114) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010004B12Rik; ABH4; Abj4; alkB homolog 4, lysine demethylase; alkB homolog 4, lysine demthylase; alkB, alkylation repair homolog 4; alkB, alkylation repair homolog 4 (E. coli); Alkbh4; Alkylated DNA repair protein alkB homolog 4; alpha-ketoglutarate-dependent dioxygenase alkB homolog 4; DNA N6-methyl adenine demethylase ALKBH4; Lysine-specific demethylase ALKBH4; probable alpha-ketoglutarate-dependent dioxygenase ABH4; RGD1308608
Common Name ALKBH4
Gene Symbol ALKBH4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.