Invitrogen™ Human ALK (aa 219-335) Control Fragment Recombinant Protein

Product Code. 30198359

Brand: Invitrogen™ RP89810

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Anaplastic Lymphoma Receptor Tyrosine Kinase (ALK) belongs to the insulin receptor superfamily. It is vital for brain development. Mutations, rearrangements, and amplifications in the ALK gene have been found in tumors, including anaplastic large cell lymphoma, neurblastoma, and non-small cell lung cancer. Chromosomal rearrangement is the most common genetic alteration. The translocation creates a fusion gene consisting of the ALK gene and the nucleophosmin gene: the 3' half of ALK, derived from chromosome 2, is fused to the 5' portion of NPM from chromosome 5. A recent study shows that the product of the NPM-ALK fusion gene is oncogenic. The deduced amino acid sequences reveal that ALK is a novel receptor protein-tyrosine kinase having a putative transmembrane domain and an extracellular domain. These sequences are absent in the product of the transforming NPM-ALK gene. ALK shows the greatest sequence similarity to LTK. ALK plays an important role in the development of the brain and exerts its effects on specific neurons in the nervous system.

Specifications

• Accession Number: Q9UM73
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 238
• Name: Human ALK (aa 219-335) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Alk; ALK tyrosine kinase receptor; ALK/NPM1 fusion gene; anaplastic lymphoma kinase; Anaplastic lymphoma kinase Ki1; Anaplastic Lymphoma Kinase p80; anaplastic lymphoma receptor tyrosine kinase; CD246; CD246 antigen; EC 2.7.10.1; kinase ALK; mutant anaplastic lymphoma kinase; NBLST3; npm-alk; p80; Tcrz; TFG/ALK
• Common Name: ALK
• Gene Symbol: ALK
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining