Invitrogen™ Human ALG3 (aa 69-122) Control Fragment Recombinant Protein

Product Code. 30201435

Brand: Invitrogen™ RP100008

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60924 (PA5-60924. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ALG3 family. The encoded protein catalyzes the addition of the first dol-P-Man derived mannose in an alpha 1,3 linkage to Man5GlcNAc2-PP-Dol. Defects in this gene have been associated with congenital disorder of glycosylation type Id (CDG-Id) characterized by abnormal N-glycosylation. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q92685
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10195
• Name: Human ALG3 (aa 69-122) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ALG3; ALG3, alpha-1,3- mannosyltransferase; asparagine-linked glycosylation 3 homolog (S. cerevisiae, alpha-1,3-mannosyltransferase); asparagine-linked glycosylation 3 homolog (yeast, alpha-1,3-mannosyltransferase); asparagine-linked glycosylation 3, alpha-1,3- mannosyltransferase homolog; asparagine-linked glycosylation protein 3 homolog; carbohydrate deficient glycoprotein syndrome type IV; CDG1D; CDGS4; CDGS6; D16Ertd36e; Dolichyl-phosphate-mannose--glycolipid alpha-mannosyltransferase; dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase; dol-P-Man dependent alpha(1-3)-mannosyltransferase; dol-P-Man dependent alpha-1,3- mannosyltransferase; Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase; dol-P-Man:Man(5)GlcNAc(2)-PP-Dol3-mannosyltransferase; dol-P-Man-dependent alpha(1-3)-mannosyltransferase; not; Not56; NOT56L; Not56-like protein
• Common Name: ALG3
• Gene Symbol: ALG3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining