Invitrogen™ Human ALG2 (aa 319-413) Control Fragment Recombinant Protein

Product Code. 30182620

Brand: Invitrogen™ RP98411

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59606 (PA5-59606. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ALG2 is a member of the glycosyltransferase 1 family. It acts as an alpha 1, 3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii).This gene encodes a member of the glycosyltransferase 1 family. The encoded protein acts as an alpha 1, 3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii).

Specifications

• Accession Number: Q9H553
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 85365
• Name: Human ALG2 (aa 319-413) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110018A23Rik; 1300013N08Rik; Alg2; ALG2 alpha-1,3/1,6-mannosyltransferase; ALG2, alpha-1,3/1,6-mannosyltransferase; ALPG2; alpha-1,3/1,6-mannosyltransferase ALG2; alpha-1,3-mannosyltransferase ALG2; asparagine-linked glycosylation 2 (alpha-1,3-mannosyltransferase); asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1,3-mannosyltransferase); asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase); asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog; asparagine-linked glycosylation protein 2 homolog; CDGIi; CMS14; CMSTA3; FLJ14511; FLJ14511 protein; GDP-Man:Man(1)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase; GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase; GDP-Man:Man(2)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase; hALPG2; homolog of yeast ALG2; im:7145131; LOW QUALITY PROTEIN: alpha-1,3/1,6-mannosyltransferase ALG2; MNCb-5081; NET38; UNQ666/PRO1298
• Common Name: ALG2
• Gene Symbol: ALG2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining