Invitrogen™ Human Aldolase A (aa 23-128) Control Fragment Recombinant Protein

Product Code. 30205476

Brand: Invitrogen™ RP101640

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aldolase encodes a member of the class I fructose-bisphosphate aldolase protein family. The encoded protein is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Mutations in this gene have been associated with Glycogen Storage Disease XII, an autosomal recessive disorder associated with hemolytic anemia. Disruption of this gene also plays a role in the progression of multiple types of cancers. Related pseudogenes have been identified on chromosomes 3 and 10.

Specifications

• Accession Number: P04075
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 226
• Name: Human Aldolase A (aa 23-128) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ALDA; Aldo1; Aldo-1; ALDOA; Aldolase 1; aldolase 1, A isoform; aldolase A; aldolase A, fructose-bisphosphate; aldolase, fructose-bisphosphate A; epididymis secretory sperm binding protein Li 87 p; fructose-1,6-bisphosphate triosephosphate-lyase; fructose-bisphosphate aldolase A; GSD12; HEL-S-87 p; Lung cancer antigen NY-LU-1; muscle-type aldolase; RNALDOG5; unnamed protein product
• Common Name: Aldolase A
• Gene Symbol: ALDOA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining