Invitrogen™ Human ALDH7A1 (aa 310-434) Control Fragment Recombinant Protein

Product Code. 30211511

Brand: Invitrogen™ RP93154

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54750 (PA5-54750. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.

Specifications

• Accession Number: P49419
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 501
• Name: Human ALDH7A1 (aa 310-434) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 26 g turgor protein homolog; Ald7a1; aldehyde dehydrogenase 7 family member A1; aldehyde dehydrogenase 7 family, member A1; aldehyde dehydrogenase family 7 member A1; aldehyde dehydrogenase family 7, member A1; Aldh7a1; Alpha-AASA dehydrogenase; alpha-aminoadipic semialdehyde dehydrogenase; antiquitin; Antiquitin 1; Antiquitin1; Antiquitin-1; ATQ1; Betaine aldehyde dehydrogenase; D18Wsu181e; delta1-piperideine-6-carboxylate dehydrogenase; delta1-piperideine-6-carboxylate dehydrogenease; EPD; P6c dehydrogenase; PDE
• Common Name: ALDH7A1
• Gene Symbol: ALDH7A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHTETFAPILY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining