Invitrogen™ Human ALDH5A1 (aa 297-396) Control Fragment Recombinant Protein

Product Code. 30204732

Brand: Invitrogen™ RP94683

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83102 (PA5-83102. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aldh5A1 is a member of the aldehyde dehydrogenase superfamily, a group of NAD(P)(+)-dependent enzymes that catalyze the oxidation of a wide spectrum of aliphatic and aromatic aldehydes. Aldehyde dehydrogenase enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. Aldh5A1 is a mitochondrial NAD(+)-dependent succinic semialdehyde dehydrogenase. A deficiency of this enzyme, known as 4-hydroxybutyricaciduria, results in a disorder of the neurotransmitter 4-aminobutyric acid (GABA). Symptoms usually include static encephalopathy, associated with developmental delays, hypotonia, ataxia, speech defects, and seizures. At least two isoforms of Aldh5A1 are known to exist.

Specifications

• Accession Number: P51649
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7915
• Name: Human ALDH5A1 (aa 297-396) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330403E24Rik; Ahd1; Ahd-1; aldehyde dehydrogenase 1, mitochondrial; aldehyde dehydrogenase 5 family member A1; aldehyde dehydrogenase 5 family, member A1; aldehyde dehydrogenase 5 family, member A1 (succinate-semialdehyde dehydrogenase); aldehyde dehydrogenase family 5 member A1; aldehyde dehydrogenase family 5, subfamily A1; ALDH5A1; aldhehyde dehydrogenase family 5, subfamily A1; D630032B01Rik; mitochondrial succinate semialdehyde dehydrogenase; NAD(+)-dependent succinic semialdehyde dehydrogenase; OTTMUSG00000000613; SSADH; SSDH; Ssdh1; Succinate-semialdehyde dehydrogenase, mitochondrial; succinic semialdehyde dehydrogenase
• Common Name: ALDH5A1
• Gene Symbol: ALDH5A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining