Invitrogen™ Human ALDH3A2 (aa 365-462) Control Fragment Recombinant Protein

Product Code. 30201833

Brand: Invitrogen™ RP89972

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53232 (PA5-53232. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aldh3A2 is a member of the aldehyde dehydrogenase superfamily, a group of NAD(P)(+)-dependent enzymes that catalyze the oxidation of a wide spectrum of aliphatic and aromatic aldehydes. Aldehyde dehydrogenase enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. Aldh3A2 catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acids. Mutations in the Aldh3A2 gene cause Sjogren-Larrson syndrome, an inherited neurocutaneous disorder. Patients with this disorder display ichthyosis, mental retardation and spastic diplegia. The pathogenesis of the cutaneous and neurological symptoms is thought to result from abnormal lipid accumulation in the membranes of skin and brain, the formation of aldehyde Schiff base adducts with amine-containing lipids or proteins, or defective eicosanoid metabolism.

Specifications

• Accession Number: P51648
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 224
• Name: Human ALDH3A2 (aa 365-462) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Ahd3; Ahd-3; Ahd-3 r; Ahd3-r; AI194803; alcohol dehydrogenase family 3, subfamily A2; aldehyde dehydrogenase 10; Aldehyde dehydrogenase 3; aldehyde dehydrogenase 3 family member A2; aldehyde dehydrogenase 3 family, member A2; aldehyde dehydrogenase 3A2; aldehyde dehydrogenase 4; Aldehyde dehydrogenase family 3 member A2; aldehyde dehydrogenase family 3 member A2; fatty aldehyde dehydrogenase; aldehyde dehydrogenase family 3, subfamily A2; ALDH10; Aldh3; Aldh3a2; Aldh4; Aldh4-r; DKFZp686E23276; FALDH; fatty aldehyde dehydrogenase; Fatty aldehyde dehydrogenase-like protein; FLJ20851; microsomal aldehyde dehydrogenase; msALDH; QccE-15682; SLS
• Common Name: ALDH3A2
• Gene Symbol: ALDH3A2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining