Invitrogen™ Human ALDH1L2 (aa 388-459) Control Fragment Recombinant Protein

Product Code. 30194190

Brand: Invitrogen™ RP108438

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84407 (PA5-84407. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of both the aldehyde dehydrogenase superfamily and the formyl transferase superfamily. This member is the mitochondrial form of 10-formyltetrahydrofolate dehydrogenase (FDH), which converts 10-formyltetrahydrofolate to tetrahydrofolate and CO2 in an NADP(+)-dependent reaction, and plays an essential role in the distribution of one-carbon groups between the cytosolic and mitochondrial compartments of the cell. Alternatively spliced transcript variants have been found for this gene.

Specifications

• Accession Number: Q3SY69
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 160428
• Name: Human ALDH1L2 (aa 388-459) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 10-formyltetrahydrofolate dehydrogenase ALDH1L2; aldehyde dehydrogenase 1 family member L2; aldehyde dehydrogenase 1 family, member L2; aldehyde dehydrogenase 1L2; Aldehyde dehydrogenase family 1 member L2; aldehyde dehydrogenase family 1 member L2, mitochondrial; ALDH1L2; D330038I09Rik; mitochondrial 10-formyltetrahydrofolate dehydrogenase; Mitochondrial 10-FTHFDH; mtFDH; probable 10-formyltetrahydrofolate dehydrogenase ALDH1L2
• Common Name: ALDH1L2
• Gene Symbol: ALDH1L2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KCGGLQLQNEDVYMATKFEGFIQKVVRKLRGEDQEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining