missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203124

Invitrogen™ Human ALDH1B1 (aa 329-379) Control Fragment Recombinant Protein

Product Code. 30203124
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203124

Brand: Invitrogen™ RP109612

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aldehyde dehydrogenases (ALDHs) mediate NADP+-dependent oxidation of aldehydes into acids during detoxification of alcohol-derived acetaldehyde, lipid peroxidation and metabolism of corticosteroids, biogenic amines and neurotransmitters. Alcohol drinking habits and cardiovascular disease risk factors may be associated with ALDH gene variants. ALDH1B1 (Aldehyde dehydrogenase family 1 member B1), also known as ALDH5 or ALDHX (Aldehyde dehydrogenase X, mitochondrial), is a 517 amino acid mitochondrial protein that is expressed in the liver, testis and to a lesser extent in brain. ALDH1B1 belongs to the aldehyde dehydrogenase family and may play a major role in ethanol detoxification.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P30837
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 219
Name Human ALDH1B1 (aa 329-379) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2700007F14Rik; acetaldehyde dehydrogenase 5; aldehyde dehydrogenase 1 family member B1; aldehyde dehydrogenase 1 family, member B1; aldehyde dehydrogenase 1B1; aldehyde dehydrogenase 5; Aldehyde dehydrogenase family 1 member B1; aldehyde dehydrogenase X, mitochondrial; ALDH class 2; ALDH1B1; ALDH5; ALDHX; MGC2230
Common Name ALDH1B1
Gene Symbol ALDH1B1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.