Invitrogen™ Human ALDH1A2 (aa 348-469) Control Fragment Recombinant Protein

Product Code. 30210380

Brand: Invitrogen™ RP89838

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52684 (PA5-52684. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein belongs to the aldehyde dehydrogenase family of proteins. The product of this gene is an enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. Retinoic acid, the active derivative of vitamin A (retinol), is a hormonal signaling molecule that functions in developing and adult tissues. The studies of a similar mouse gene suggest that this enzyme and the cytochrome CYP26A1, concurrently establish local embryonic retinoic acid levels which facilitate posterior organ development and prevent spina bifida. Three transcript variants encoding distinct isoforms have been identified for this gene.

Specifications

• Accession Number: O94788
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8854
• Name: Human ALDH1A2 (aa 348-469) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AL1A2; alcohol dehydrogenase family 1, subfamily A2; alcohol dehydrogenase family 1, subfamily A7; aldehyde dehydrogenase 1 family member A2; aldehyde dehydrogenase 1 family, member A2; aldehyde dehydrogenase 1A2; aldehyde dehydrogenase family 1 member A2; aldehyde dehydrogenase family 1, subfamily A2; Aldh1a2; Aldh1a7; AV116159; fb50h01; neckless; nls; nof; no-fin; RALDH 2; RALDH(II); Raldh1; RALDH2; Raldh-2; RALDH2-T; retinal dehydrogenase 2; retinal dehydrogenase, type II; retinaldehyde dehydrogenase 2; retinaldehyde dehydrogenase type 2; retinaldehyde-specific dehydrogenase type 2
• Common Name: ALDH1A2
• Gene Symbol: ALDH1A2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining