missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ALDH1A1 (aa 315-428) Control Fragment Recombinant Protein

Product Code. 30200773
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30200773 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30200773 Supplier Invitrogen™ Supplier No. RP101895

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110653 (PA5-110653. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ALDH1A1 belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P00352
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 216
Name Human ALDH1A1 (aa 315-428) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias acetaldehyde dehydrogenase 1; Ahd2; Ahd-2; alcohol dehydrogenase family 1, subfamily A1; alcohol dehydrogenase family 1, subfamily A2; ALDC; aldehyde dehydrogenase 1 family member A1; aldehyde dehydrogenase 1 family, member A1; Aldehyde dehydrogenase 1 soluble; aldehyde dehydrogenase 1, liver cytosolic (class 1); aldehyde dehydrogenase 1, soluble; aldehyde dehydrogenase 1, subfamily A1; aldehyde dehydrogenase 1A1; aldehyde dehydrogenase 2; aldehyde dehydrogenase family 1 member A1; aldehyde dehydrogenase family 1, member A1; aldehyde dehydrogenase family 1, subfamily A1; aldehyde dehydrogenase, cytosolic; aldehyde dehydrogenase, liver cytosolic; Aldh; ALDH class 1; Aldh1; ALDH11; ALDH1A1; Aldh1a2; Aldh2; ALDH-E1; ALHDII; E1; epididymis luminal protein 12; epididymis luminal protein 9; epididymis secretory sperm binding protein Li 53 e; epididymis secretory sperm binding protein Li53e; HEL12; HEL-9; HEL-S-53 e; MGC2318; PUMB1; RALDH 1; ralDH1; Retinal dehydrogenase 1; retinaldehyde dehydrogenase 1
Common Name ALDH1A1
Gene Symbol ALDH1A1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.