Invitrogen™ Human ALDH1A1 (aa 315-428) Control Fragment Recombinant Protein

Product Code. 30200773

Brand: Invitrogen™ RP101895

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110653 (PA5-110653. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ALDH1A1 belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme.

Specifications

• Accession Number: P00352
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 216
• Name: Human ALDH1A1 (aa 315-428) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: acetaldehyde dehydrogenase 1; Ahd2; Ahd-2; alcohol dehydrogenase family 1, subfamily A1; alcohol dehydrogenase family 1, subfamily A2; ALDC; aldehyde dehydrogenase 1 family member A1; aldehyde dehydrogenase 1 family, member A1; Aldehyde dehydrogenase 1 soluble; aldehyde dehydrogenase 1, liver cytosolic (class 1); aldehyde dehydrogenase 1, soluble; aldehyde dehydrogenase 1, subfamily A1; aldehyde dehydrogenase 1A1; aldehyde dehydrogenase 2; aldehyde dehydrogenase family 1 member A1; aldehyde dehydrogenase family 1, member A1; aldehyde dehydrogenase family 1, subfamily A1; aldehyde dehydrogenase, cytosolic; aldehyde dehydrogenase, liver cytosolic; Aldh; ALDH class 1; Aldh1; ALDH11; ALDH1A1; Aldh1a2; Aldh2; ALDH-E1; ALHDII; E1; epididymis luminal protein 12; epididymis luminal protein 9; epididymis secretory sperm binding protein Li 53 e; epididymis secretory sperm binding protein Li53e; HEL12; HEL-9; HEL-S-53 e; MGC2318; PUMB1; RALDH 1; ralDH1; Retinal dehydrogenase 1; retinaldehyde dehydrogenase 1
• Common Name: ALDH1A1
• Gene Symbol: ALDH1A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining